Catalyzes the ATP-dependent activation of L-alanine, and to a lesser extent of L-glycine and L-serine, and their transfer to the phosphopantetheine prosthetic group covalently attached to the vicinal carrier protein Atu2571 of yet unknown function. May participate in nonribosomal peptide synthesis or related processes. L-proline and L-glutamate are very poor substrates whereas D-amino acids are not substrates for ATP-dependent activation. Does not display tRNA aminoacylation activity.

Belongs to the class-II aminoacyl-tRNA synthetase family. Amino acid--[acyl-carrier-protein] ligase subfamily.

327 amino acids

MTVFSAIPPISCWFTGRTPASWDKTMDMQTSFLDRLFEEGLLIETGVDGLYGRSGQFEDVIAAFERLIDRTGGADGAEAIRFPPGINRAYFEKSGYMKSFPQLAGTVHSFCGCELDHVSLLKSMDEGGDWTKDQKATDIVLTPAACYPLYPTIAKRGALPAGGGLYDIQSYCFRHEPSKDPARQQLFRMREYVCMGTESDVTEFRQTWMDRGVEMMKAVGLDVTIDIANDPFFGRAGKMLANNQRDQNLKFELLIPVTSATNPTACMSFNYHQDAFGQKWGLNLENGDVAHTACVGFGLERIALALFAHHGLDVKKWPAKVVETLWG

36.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Atu2573 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here