Catalytic subunit of the tRNA-splicing ligase complex that acts by directly joining spliced tRNA halves to mature-sized tRNAs by incorporating the precursor-derived splice junction phosphate into the mature tRNA as a canonical 3',5'-phosphodiester. May act as an RNA ligase with broad substrate specificity, and may function toward other RNAs.

Belongs to the RtcB family.

506 amino acids

MVVRDYNTELTYIERISTNSFRIKKGFQPNMNVEGIFYANSRLEKLMFDELRNSCRPGMTGGFLPGVKQIANVAALPGIVGRSVGLPDIHSGYGFAIGNMAAFDMSDPTSIVSPGGVGFDINCGVRLLRTNLFEKDVKPVQEQLAQSLFDHIPVGVGSKGIIPMNAHDLEEALEMGMDWSLREGYVWAEDKEHCEEYGRMLTADPSKVSMRAKKRGLPQLGTLGAGNHYAEIQVVEEIYDKYAASKMGIEELGQICVMIHSGSRGFGHQVATDALVEMEKAMKRDKIETNDRQLACARINSVEGQNYLKAMSAAANFAWVNRSSMTFLTRQAFAKQFNTTPDDLDMHVIYDVSHNVAKIEEHIVDGRPKQLLVHRKGSTRAFPPHHPLIPVDYQLTGQPVLVGGSMGTCSFVLTGTEKGMAETFGSTCHGAGRSLSRAKSRRNLDYKDVLRDLEAKGISIRVASPKLVQEEAPDSYKDVRDVVQTCHDVGISSKCIKLRPIAVIKG

55.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CPIJ004874 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here