Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. Probably carries the active site for 5'-splice site cleavage (By similarity).

Belongs to the tRNA-intron endonuclease family.

237 amino acids

MAPRWKWKGAEAKALAEPVSKTVSELRSSLTQTEALGFLSSCNVLLSVESEEAELLDRCCFGRLVVGAEKDKRWIQLSFEEAFFLFYKLKCIKICLHGRSLENEVDLWRSMSSFKQDFAILYKAYSHLRSKNWIVRSGLQYGVDFVVYRHHPSLVHSEYAVLVQSIGGNDRLKVWSDIHCSVRLTGSVAKSLLVLYVNRKVNTEKMNLPLCLEDYTVEEQTIRRWSPELSREDETRT

27.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SEN1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here