Folate-binding protein involved in regulating the level of ATP-DnaA and in the modification of some tRNAs. It is probably a key factor in regulatory networks that act via tRNA modification, such as initiation of chromosomal replication.

Belongs to the tRNA-modifying YgfZ family.

331 amino acids

MNLNAPFSPQPPLAAEHLPLTLMRLDDWLPINVSGPDAQSYLQGQLTADLPSLAATQHTLCGHCDAQGKLWSSLRLLRRRDGFTYLLRRSVATLQMLELKKYAVFAKASIVSDEGAVLLGVAGAQASEALGALFPRLPDADAPLLQAGRSHLLYMAWPQPRYLLICDDADEAERIFAPLSARARLADSAQWLALDIESGIPLIDEPNCDSFLPQAVNLQALGGISFTKGCYSGQEMVARAKYRGANRRALFWLRGSAERLPHASEDLELRLGDSWRRSGTVLAAQRLADGGVYLQAVLSSDLPADSVLRVRDDARSQLTLSPLPYSTDQQE

36.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make NT01EI_3346 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here