Ligates lysine onto the cytidine present at position 34 of the AUA codon-specific tRNA(Ile) that contains the anticodon CAU, in an ATP-dependent manner. Cytidine is converted to lysidine, thus changing the amino acid specificity of the tRNA from methionine to isoleucine.

Belongs to the tRNA(Ile)-lysidine synthase family.

452 amino acids

MVEKKFLEAVKKYSLISEGDRILVAFSGGIDSTVLTYLLIKFRDHLKISDIYLAHLNHSLRKESDEDQRFCEDFAKKYGLEIFTKKVDIKSLAEKEKKSIEQKAREERYSFFRKVMEERSINRLATGHHLSDLVETMIMWFIQGNRKGIKGFRPKERDIIRPLYLINKDQIENYAREKGIEYRIDITNFETDFLRNRIRHNIIPHIKGINPSLEGSLLTLSYFLSLDDQYLEEESEKISQKFLNGKIELEELLVYDKALVYRAIQNWIYRKTGVYPSYRQIMDIMEIIEKKEGTKSIRLSPEYNLIRRYSTLYIEKVKEKTEPYQYRIKPGEKIFVKEANLYIKSYIETDYTLDKLKDERKKVCFQIESMEDAEFVVRNRRKGDRFIPFGRKKEKKLKDVMIDLKIPSDMRENIPLVVYGNKILWIAGYKRSAYFPVTEKGKKLICFELEEV

53.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make tilS using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here