Probable S-adenosyl-L-methionine-dependent methyltransferase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA (By similarity). May methylate the carboxyl group of leucine residues to form alpha-leucine ester residues.

Belongs to the methyltransferase superfamily. LCMT family.

686 amino acids

MGPRGRQRRAGTVQSTNDSSSLSKRSLAAHGYVRDPFAALLVPGPVRRTPLIHRGYYVRARAVRHCVRAFLELTSALPSRTRAQILSLGSGSDSLYFRLKAAGLLARAAVWEVDFPDVSRLKAERIEETPELRAQTGPFKIGDSASSLCFESADYRILGADLRELQRLGEALDGAGLDATSPTLLLAEAVLTYLEPSSATALIAWAAQRFPDALFVIYEQMQPGDAFGQIMLQHFQRLHSPLHGLELFPVVKAQRQRFLQAGWTACSALDLNEFYRRLLSAEERQRVETLEPFDEYEEWHLKCSHYFILAASRGDILSETPVFEPSEASFQIDPASPSGFLSARVVTSDHQHSSLKRYGHASALLSPGVIFSAGGFGEQEGRHCRVSRFHVLSRSCDSEWEGCQISTLGTEGQWDGRLYHTMTRLSDTRVLVLGGRLSPVSPASGALQLDLYKSKDNCSEGQNVTVTKAALEEGSVLSCWRHSTTEVYYQNQRYLFVYGGRSVAEPVLSDCRFLHVETMAWVRIPVQGASPEGRHSHSACSWQGGALIAGGLGASEELLSSVLFLKPVSSGFLWESIDIQPSITPRYSHTAHVFNGKLLLVGGVWIHSSSVPGVTVICLTTGLSSEYQIDTASVPWPLMLHNHSSALLPEEQQLLLIGGGGNCFSFGTYFNPHTVALDLSSLRSGQ

75.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Lcmt2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here