Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A).

Belongs to the IPP transferase family.

314 amino acids

MRPLAIIGPTGSGKSQLALDVAERLAGEVPAEIVNADAMQLYRGMDIGTAKLSVAARRGIPHHQLDVLNVAETATVARYQQAAAADIEAIIARGHVPIVVGGSMLYVQSLLDNWSFPATDPAVRARWEECLAELGVGELHAELARRDPAAAATILPTDGRRIVRALEVIELTGQPFAASAPRIGAAQWGTAIIGLDCDTPILDDRLAVRTDSMFERGLVEEVRVLLRAGLRDGVTAARALGYAQVLAALDAGGGAELLDDAREQTYFGTRRYVRRQRSWFRRDHRVHWCDAGATGPSDRAAMVDEALRVWRHVT

34 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make miaA2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here