About Products Protein Database Contact

Protein expression services for selU | tRNA 2-selenouridine synthase

Description
Involved in the post-transcriptional modification of the uridine at the wobble position (U34) of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Catalyzes the conversion of 2-thiouridine (S2U-RNA) to 2-selenouridine (Se2U-RNA). Acts in a two-step process involving geranylation of 2-thiouridine (S2U) to S-geranyl-2-thiouridine (geS2U) and subsequent selenation of the latter derivative to 2-selenouridine (Se2U) in the tRNA chain.
Family
Belongs to the SelU family.
Species
Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)
Length
366 amino acids
Sequence
MSALPLATDYARIFLDDVPLIDLRAPIEFKEGAFPCSTNLPLMTDDERAQVGTCFKQQGQAAAIALGHQLVGGAVRAERLEGWLAQLRRQPDAVLYCFRGGLRSQTVQQWLHEAGVTRPRIAGGYKDLRRFLIDTLDGAAAECQWTVLTGMTGSGKTHMLAEVAQALDLEGHAHHRGSSFGQLPGGQPSNINFENNLAIELLKRRHQGEQAFVVEDESRLIGRCCLPNPLFDAMSQAPLVVVEVPQEERAEQIRQDYVHDLWLRYQAMFGAEEGWPLFAAYLTDALARLKRRLGDQAHRELDTLMQSALAEQASSGDTSLHLAWITLLLTRYYDPMYLYQLGNKRERIIFQGDKQACLDFFAKQRA
Mass
41 kDa
Simulated SDS-PAGE
Western blot of selU recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make selU using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here