Protein expression services for abgB | p-aminobenzoyl-glutamate hydrolase subunit B
Description
Component of the p-aminobenzoyl-glutamate hydrolase multicomponent enzyme system which catalyzes the cleavage of p-aminobenzoyl-glutamate (PABA-GLU) to form p-aminobenzoate (PABA) and glutamate. AbgAB does not degrade dipeptides and the physiological role of abgABT should be clarified.
Species
Escherichia coli (strain K12)
Length
481 amino acids
Sequence
MQEIYRFIDDAIEADRQRYTDIADQIWDHPETRFEEFWSAEHLASALESAGFTVTRNVGNIPNAFIASFGQGKPVIALLGEYDALAGLSQQAGCAQPTSVTPGENGHGCGHNLLGTAAFAAAIAVKKWLEQYGQGGTVRFYGCPGEEGGSGKTFMVREGVFDDVDAALTWHPEAFAGMFNTRTLANIQASWRFKGIAAHAANSPHLGRSALDAVTLMTTGTNFLNEHIIEKARVHYAITNSGGISPNVVQAQAEVLYLIRAPEMTDVQHIYDRVAKIAEGAALMTETTVECRFDKACSSYLPNRTLENAMYQALSHFGTPEWNSEELAFAKQIQATLTSNDRQNSLNNIAATGGENGKVFALRHRETVLANEVAPYAATDNVLAASTDVGDVSWKLPVAQCFSPCFAVGTPLHTWQLVSQGRTSIAHKGMLLAAKTMAATTVNLFLDSGLLQECQQEHQQVTDTQPYHCPIPKNVTPSPLK
Mass
52.2 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make abgB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here