Responsible for methylating the 5'-cap structure of mRNAs.

Belongs to the class I-like SAM-binding methyltransferase superfamily. mRNA cap 0 methyltransferase family.

524 amino acids

MSDKEAGVASSLGSNSPINKDEVDVKNTEEHSKQESKSDINKPPLKKIKADDGIDISDSFSRRENKGNNKVISSVYNDENKKTPAWMKSKTTDKYDKYGSRSTPIATPTAPVNNPDERYSKYMTNSVNSNDRVRRPPTETTSSQYDKKRAHDEAEDDVVAPYSNLAVANPSSNLYQTFQSHINNREGKDINSIVRSHYNQRTQQSKFQGSRTKSPIYKLRNFNNAIKYILLGNWVKPNPDSNRPTVILDLCCGKGGDLNKCEFVSVDQYIGIDISDASIKEAFSRYSRNKARFIPQTAESKKERDTRRYNFEACFATGDCFSSSIPEILEPNFPGIIDGLFPVDCVSLQFAMHYAFETEEKVHQLLTNVTKSLRAGGTLIGTIPSSDFIRDKIVNRAFIDQENRKFGNDLYSVTFHKDPPDEGVFRPPFGNGYNYSLKDAIDDVPEYVVPFEVFRGLCEEYGLVLKYKKNFIDIFNQEIPKYFSKLNKNLIEGMKRSDGKYGAEGLEKEAVGFYIGFVFEKLGN

59.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ABD1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here