About Products Protein Database Contact

Protein expression services for KAP3 | kinetoplast-associated protein 3

Description
Histone H1-like DNA-binding protein involved in the organization and segregation of kinetoplast DNA (kDNA). The mitochondrial DNA of kinetoplastid protozoa consists of about 5,000 minicircles and 20 to 30 maxicircles. These circular DNAs are held together by catenation into a highly organized compact disk structure referred to as a kinetoplast DNA (kDNA) network. Binds preferentially to a specific fragment of minicircle DNA and is able to compact kDNA networks through DNA charge neutralization and condensation.
Family
Belongs to the KAP family.
Species
Crithidia fasciculata
Length
134 amino acids
Sequence
MLRRSPTLLRVSPFSLYMKDLAKNGTLQNDRNPAKTASRLYRKLSEPEKMALQKRAARVSYPALDAYNRFQKEYAHRFLHLSNKKRQREVSKLWAELKKNGTVKVPKAPKAAKSASSKVKTAAKTAKKTTAARK
Mass
15.3 kDa
Simulated SDS-PAGE
Western blot of KAP3 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make KAP3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here