Histone H1-like DNA-binding protein involved in the organization and segregation of kinetoplast DNA (kDNA). The mitochondrial DNA of kinetoplastid protozoa consists of about 5,000 minicircles and 20 to 30 maxicircles. These circular DNAs are held together by catenation into a highly organized compact disk structure referred to as a kinetoplast DNA (kDNA) network. Binds preferentially to a specific fragment of minicircle DNA and is able to compact kDNA networks through DNA charge neutralization and condensation.

Belongs to the KAP family.

130 amino acids

MLRRTVSNFAMSPYMLFISDLAKTGKLKGIRTPGKFVGKKYRQLSAKEKAALQQRAKQASTPAMTAYRRMAHREMSNKSVPIEQRRANLTKKWNETKQAQRAKAQKAQKKPKSAKSKVKKAAKKAKKSKK

14.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make KAP2-2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here