Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids.

Belongs to the Maf family. YhdE subfamily.

187 amino acids

MGSGKPPLILASGSPRRKALLEALGYPIRVAVPGVEEEGLPLPPKALAQALARRKGEAVQGEWVLAADTVVDLDGEVLGKPKDPEENRLFLRRLSGRLHLVHTAFYLRTPKEVVEEVHTARVFFRPLSEEEIAWYVGSGEGLDKAGGYGAQGLGMALLERVEGDFYTVVGLPVSRVFALLWARGFRP

20.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TTHA1188 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here