Probably involved in the biosynthesis of the acarviose moiety of the alpha-glucosidase inhibitor acarbose (PubMed:10196166). Catalyzes the dehydration of dTDP-D-glucose to form dTDP-6-deoxy-D-xylo-4-hexulose via a three-step process involving oxidation, dehydration and reduction (By similarity).

Belongs to the NAD(P)-dependent epimerase/dehydratase family. dTDP-glucose dehydratase subfamily.

320 amino acids

MKILVTGGAGFIGSHFVTSLISGDIATPQPVTQVTVVDKLGYGGNLRNLAEASADPRFSFVRGDICDEGLIEGLMARHDTVAHFAAETHVDRSVVASGPFVASNLVGTQVLLDAALRHHIGRFLHVSTDEVYGSIDTGSWAEGHPLAPNSPYAASKAGSDLLALAYHQTHGMDVVVTRCSNNYGPRQFPEKMIPLFVTRLLDGLDVPVYGDGRNIRDWLHVSDHCRGLALALGAGRAGEVYHIGGGWEATNLELTEILLEACGAPASRISFVTDRKGHDRRYSLDYSKIAGELGYRPRVDFTDGIAETVAWYRANRSWWT

34.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make acbB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here