About Products Protein Database Contact

Protein expression services for rdgB | dITP/XTP pyrophosphatase

Description
Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides XTP (xanthosine triphosphate), dITP (deoxyinosine triphosphate) and ITP. Seems to function as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions.
Family
Belongs to the HAM1 NTPase family.
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Length
197 amino acids
Sequence
MQKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKMTGLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQQNLEKLLHTLRDVPDDKRQARFHCVLVYLRHAEDPTPIVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAELTREEKSAISHRGQALKLLLDALRNG
Mass
21 kDa
Simulated SDS-PAGE
Western blot of rdgB recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make rdgB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here