Description
Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides XTP (xanthosine triphosphate), dITP (deoxyinosine triphosphate) and ITP. Seems to function as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions.
Family
Belongs to the HAM1 NTPase family.
Species
Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Sequence
MHKIVFVTGNKGKFAEIRDILKTFGIEVIQEKNGYPELQEDELEPIAAHGAQYVANKLNMPVMVDDSGIFINALNGFPGPYSRFVEDKLGNLKVLKMMEGEEDRTAYFKTVIGYCEPGKEPLVFPGVVEGKIAYEERGTGGFGYDPIFEYQGLTFGELGDTEKNKVSHRRRAVDEFLEWFTSKA
Simulated SDS-PAGE
![Western blot of MA_3706 recombinant protein](/recombinant/MA_3706-1.png)
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service