Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides XTP (xanthosine triphosphate), dITP (deoxyinosine triphosphate) and ITP. Seems to function as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions.

Belongs to the HAM1 NTPase family.

184 amino acids

MHKIVFVTGNKGKFAEIRDILKTFGIEVIQEKNGYPELQEDELEPIAAHGAQYVANKLNMPVMVDDSGIFINALNGFPGPYSRFVEDKLGNLKVLKMMEGEEDRTAYFKTVIGYCEPGKEPLVFPGVVEGKIAYEERGTGGFGYDPIFEYQGLTFGELGDTEKNKVSHRRRAVDEFLEWFTSKA

20.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MA_3706 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here