About Products Protein Database Contact

Protein expression services for AF_2237 | dITP/XTP pyrophosphatase

Description
Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides xanthosine triphosphate (XTP), deoxyinosine triphosphate (dITP) and ITP. Probably functions as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions. Shows very low activity on dGTP or dUTP, and has nearly no activity toward the canonical nucleotides ATP, CTP, and TTP.
Family
Belongs to the HAM1 NTPase family.
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Length
181 amino acids
Sequence
MYFITSNEGKFREVREMASKYGIEIEWLKMEYIEPQGSSLEEIARLSAEMLAEKVEGEFVIEDSGLFVEALKGFPGPYSSYVFKTIGNEGILKLMEGVENRKAYFMAVVAYFDGKEVRTFTGKVEGEISREMRGTQGFGYDPIFLYGNKTFAEMATEEKNQVSHRRKAFEEFFRWLKENKI
Mass
21 kDa
Simulated SDS-PAGE
Western blot of AF_2237 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make AF_2237 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here