Bifunctional enzyme that catalyzes both the deamination of dCTP to dUTP and the hydrolysis of dUTP to dUMP without releasing the toxic dUTP intermediate.

Belongs to the dCTP deaminase family.

178 amino acids

MILSDKTILKMLAEKTLIIEPLEKEQIQPASVDIRLGNTFSIVEDSCTGIINLEKEVKYKTITSDTYILLPNQFVLATTMEYFELPNNLTAFVEGRSSLGRLGLFIQNAGWVDPGFKGEITLELFNANRCAIELKAGRRVGQLVFAKMDDTALNPYKGKYQGQKGATGSRVFLDYEVK

19.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dcd using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here