Protein expression services for KSE_12950 | (+)-corvol ether B synthase/(+)-corvol ether A synthase ((2E,6E)-farnesyl diphosphate cyclizing)
Description
Catalyzes the conversion of (2E,6E)-farnesyl diphosphate (FPP) into (+)-corvol ether A and (+)-corvol ether B via a 1,10-cyclization, which requires isomerization of FPP to nerolidyl diphosphate (NPP) and then abstraction of the pyrophosphate from intermediate NPP leading to a (E,Z)-germacradienyl (helminthogermacradienyl) cation (PubMed:25809275, PubMed:27666571). The preferred substrate is (2E,6E)-farnesyl diphosphate (FPP), however geranyl diphosphate (GPP) is also able to produce small amounts of several acyclic and cyclic monoterpenes, with linalool as the main product (PubMed:25809275).
Family
Belongs to the terpene synthase family.
Species
Kitasatospora setae (strain ATCC 33774 / DSM 43861 / JCM 3304 / KCC A-0304 / NBRC 14216 / KM-6054)
Length
320 amino acids
Sequence
MIPRFDFPWPSACHPHARQAEQGALAFAERHGLVPTAAYRSRLERTRYGWLAARCYPDADDVLLQLCADYFIWFFIVDDLFVDRVDTLSERTIPNLTAMIDVLDHHRPGAEPVFGEHAWLDVCTRLRAYLSDEHFQRFAHGMRMWAATAGLQIANHLGADTVDVAPYETIRRHTSGTNPCLALADAAKHGPVTPAEYHSPPVQRLVLHANNVVCWSNDVQSLKMELNQPGQYWNMAAIYAHRGLSLQQAVDLVALRVRGEIASFQSLALTLEPHASRPLRGFVDGLRHWMRGYQDWVENDTLRYADAFIAEDADDTAVRT
Mass
36.2 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make KSE_12950 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here