About Products Protein Database Contact

Protein expression services for Arpp19 | cAMP-regulated phosphoprotein 19

Description
Protein phosphatase inhibitor that specifically inhibits protein phosphatase 2A (PP2A) during mitosis. When phosphorylated at Ser-62 during mitosis, specifically interacts with PPP2R2D (PR55-delta) and inhibits its activity, leading to inactivation of PP2A, an essential condition to keep cyclin-B1-CDK1 activity high during M phase (By similarity). May indirectly enhance GAP-43 expression by binding to the NGF-regulatory region of its mRNA.
Family
Belongs to the endosulfine family.
Species
Rattus norvegicus
Length
112 amino acids
Sequence
MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPAAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG
Mass
12.3 kDa
Simulated SDS-PAGE
Western blot of Arpp19 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Arpp19 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here