Protein expression services for kin-1 | cAMP-dependent protein kinase catalytic subunit
Description
Essential for larval development. Controls the rhythmic contraction of enteric muscles probably by regulating G-protein coupled receptor aex-2-mediated calcium influx in GABAergic DVB neurons. Plays a role in the control of oocyte meiotic maturation by gonadal sheath cells. May play a role in the regulation of neuromuscular junctions.
Family
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. cAMP subfamily.
Species
Caenorhabditis briggsae
Length
374 amino acids
Sequence
MLKFLKPKSSDEGSSKDNKSAASLKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQRKIKPPSFSNGEPKGRLFEALYARVDGPADTRHFVEEVQEPTQFVIASTCQLPELFEDF
Mass
43 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make kin-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here