Probably not involved in maintaining the position of ASI and ASH head neuron cell bodies and ventral nerve cord axons of PVQ, PVP, RMEV, AVK and HSN neurons.

243 amino acids

MTKLCLLLLPLVFLVSYSFAEEEITISISPNANPVQKPIGHQISLVCSIKKTDSNGEKPGMIWKKHGGLDRTGNVEVKKLDDYTLGLIIRNSSVEDSGVYYCQAQVGSKVYMNKMDVIVFEDIVFRDKQLHFGQVLATASVNISCEVSAKKDSVITYWTRHGKQILEGGKHKFYSRGSILEIQNYQPEQDAGQYTCEVFHVSSGSSNTKTVTLGTTGEKNYVACQQMCNSFCTDVHNKVFTNN

27.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make zig-6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here