Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter (By similarity). May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells.

Belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family. SLC30A subfamily.

368 amino acids

MEFLERTYLVNDQATKMYAFTSDRERGQKPVNKDQCPGDGPERPEAGAIYHCHNSFKATGNRSSKQVHAKWRLCAASAICFFFMVAEVVGGHVAGSLAVLTDAAHLLIDLTSFLLSLFSLWLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLVYLACERLLYPDYQIQAGIMITVSGCAVAANIVLTLILHQRHLGHNHKDAQANASVRAAFVHALGDVFQSTSVLISALIIYFKPDYKMADPVCTFISSVLALASTVMILKDFSILLMEGVPKGLSYNSVKELLLTVDGVISVHNLHIWSLTVNQVILSVHVATAASQDSQSVRTGIACALSSSFDLHSLTIQIESAADQDPSCLLCEDPQD

40.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Slc30a8 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here