May interact with and stimulate the activity of the PRC2 complex, which methylates 'Lys-9' and 'Lys-27' residues of histone H3 (By similarity). DNA-binding transcriptional repressor.

Belongs to the AEBP2/jing C2H2-type zinc-finger family.

504 amino acids

MAAALADMADLEELSRLSPLSPGSPGPAARGRAEPPEEEEEEDDEEAEAEAVAALLLNGGAGGGAGGGEAETMSEPSPESASQAGGDEDEDEEDDEDEGSSSGGAEEESSAESLVGSSSGGCSGDETRSLSPGAASSSSGDGDGKEGLEEPKGPRGGPGGPGSSGGGSSSSSVVSSGGDEGYGTGGGGSSATSGGRRGSLEMSSDGEPLSRMDSEDSISSTLMDIDSTISSGRSTPAMMNGQGSTTASSKHIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEESGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKRFDILNFPR

53 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Aebp2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here