About Products Protein Database Contact

Protein expression services for ZFYVE21 | Zinc finger FYVE domain-containing protein 21

Description
Plays a role in cell adhesion, and thereby in cell motility which requires repeated formation and disassembly of focal adhesions. Regulates microtubule-induced PTK2/FAK1 dephosphorylation, an event important for focal adhesion disassembly, as well as integrin beta-1/ITGB1 cell surface expression (By similarity).
Species
Bos taurus
Length
254 amino acids
Sequence
MSSEVAARRDAKKLVRSPSGLRMVPEHRAYGSPFGLEEPPWVPDKECPRCMQCDTKFDFLTRKHHCRRCGKCFCDKCCGQKVALRRMCFVDPVRQCAGCAPVSRREADFYDRQLKLLLSGATFLVTFENSEKPDTMVCRLSSNQRFLLLDGDGDGDGHREVEVARIAAVQMLTEGLPPGDTLSHTSLPASRPAAEGGNARAIGMTLQYTTPGAEGLTQLTLTAGEDADGSRRQATAWLAAMHKAAKLLYESRDQ
Mass
28 kDa
Simulated SDS-PAGE
Western blot of ZFYVE21 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ZFYVE21 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here