Description
Plays a role in cell adhesion, and thereby in cell motility which requires repeated formation and disassembly of focal adhesions. Regulates microtubule-induced PTK2/FAK1 dephosphorylation, an event important for focal adhesion disassembly, as well as integrin beta-1/ITGB1 cell surface expression (By similarity).
Sequence
MSSEVAARRDAKKLVRSPSGLRMVPEHRAYGSPFGLEEPPWVPDKECPRCMQCDTKFDFLTRKHHCRRCGKCFCDKCCGQKVALRRMCFVDPVRQCAGCAPVSRREADFYDRQLKLLLSGATFLVTFENSEKPDTMVCRLSSNQRFLLLDGDGDGDGHREVEVARIAAVQMLTEGLPPGDTLSHTSLPASRPAAEGGNARAIGMTLQYTTPGAEGLTQLTLTAGEDADGSRRQATAWLAAMHKAAKLLYESRDQ
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service