Unknown. The ortholog in A.thaliana is involved in photosystem II (PSII) assembly, but knockout of the corresponding gene in Synechoccus PCC 7002 has no effect on PSII activity.

Belongs to the Ycf48 family.

323 amino acids

MGKWSGLGLGLLLLVLAGCGAPPLERDEWKVIPTGLSDKADLLDIAFVDDKNGWAVGSRSTLLRTADGGESWTAVPVKLDSDSRFLSVSFDGKNGWIGGEPKRLLRTVNGGASWTSITLDQRLPGSPLKVYALGADTAEVVLNSGLVIKTVNGGKNWQVVTPASAGGIRSAERVADGSYWVVSTRGGSYLQWKPGDPQWTNYERTSSRRIQAMGFSSGKAGWMINQGGEMQFTANQGETWTPGRSVILNGLSLLDADYTAADKKIWAAGGGGTLIVSADDGQNWKAEEVPGIKGSLLNVEFIGNKGFVLGQNGVLLKYRGAAD

34.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make glr0855 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here