Functions in xyloglucan synthesis by adding side chains to the xylosylated glucan backbone. Involved in galactosylating hemicellulose xyloglucan (XyG) at the second position of the XXXG motif to form XLXG (PubMed:22474179). Associates with other xyloglucan-synthesizing enzymes to form multiprotein complexes for xyloglucan synthesis in the Golgi (PubMed:25392066).

Belongs to the glycosyltransferase 47 family.

517 amino acids

MLPVSNPSSPEHLLKKSRTPDSTTSIDRKNSFNSLHSVGNRSSYIAASRSHCTWLILSLLSLQLILFLTLRSIPFPHRHIPENFPSPAAVVTTTVTTTVISAASSNPPLSSSSSDERCDSGRVFVYDMPKIFNEVILQQCDNLNPWSSRCDALSNDGFGQEATSLSNVIPKDLVQSWFWTDQFVTEIIFHNRILNHRCRTLDPESATAFYIPFYAGLAVGQYLWSNYAAADRDRHCKMMTQWVKNQPYWNRSNGWDHFITMGRITWDFRRSKDEDWGSNCIYIPGMRNITRLLIERNSWDHFDVGVPYPTGFHPRSDSDVVNWQDFVRNRRRETLFCFAGAPRAGIVNDFRGLLLRHCEESRGKCRTVDCTVGKCSNGSSAILETFLGSDFCLQPRGDSFTRRSIFDCMLAGSIPVFFWRRSAYMQYQWFLPDKPDSYSVFIDRNEVTNGTTSIKEVLERYSKEDVRKMRERVIDLIPNLVYAKSPNGLETFKDAFDVAIDGVFRRFKEQEKWYKWR

59.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make XLT2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here