Fungal xylanase inhibitor. Possesses competitive inhibiting activity against several fungal endo-1,4-beta-D-xylanases belonging to glycoside hydrolase family 10 (GH10) and family 11 (GH11). May function in plant defense against secreted fungal pathogen xylanases. Is similar to class III chitinases, but does not exhibit chitinase activity.

Belongs to the glycosyl hydrolase 18 family. Xylanase inhibitor subfamily.

290 amino acids

MGLVHALLPFAAAAALLLLAAPPPATADDPGLAVYWGRHKEEGSLREACDTGRYTTVIITFYNAFGHGRYSLDISGHPLAAVGADIKHCQSRGITVLLSIGGQGGAYSLPTNASAADVADNLWNAYLGGHRAGVARPFGDDAAVDGIDFFIDQGGADHYDDLARRLDGYNKYYRGRVGVLLTATTRCSYPDHRLEKALATGVFARIHVRMFGDEQCTMSPRYSWEKWAAAFPGSKVYIGLVASPEQDSAWMFQKDLYYEMLQFVRSLPNYGGLAIYDRYFDKKANYTGEG

31.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Chib3H-h using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here