Converts the preformed base xanthine, a product of nucleic acid breakdown, to xanthosine 5'-monophosphate (XMP), so it can be reused for RNA or DNA synthesis.

Belongs to the purine/pyrimidine phosphoribosyltransferase family. Xpt subfamily.

192 amino acids

MKLLEERIRKDGEVLDGDVLKINSFLNHQVDPELMMQVGEEFKRLFENEKITKVLTCEASGIAPGIMAAYQLGVPMVFARKKKPSTLNDAVYWADVFSYTKKVNNKICVEKKFLSSDDHLLIIDDFLAHGEAVKGMLNIAKQANAAVAGVGVVVAKEFQGGSDWVKEHGYRLEALARISNFENNQVHFVGEK

21.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make xpt using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here