Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Leu-Pro-Ala. Also shows low activity towards peptides with Ala or Ser at the P1 position. Promotes TNFRSF1B-mediated phosphorylation of MAPK8/JNK1 and MAPK9/JNK2, suggesting a function as an adapter protein for TNFRSF1B; the effect is independent of XPNPEP3 peptidase activity. May inhibit apoptotic cell death induced via TNF-TNFRSF1B signaling.

Belongs to the peptidase M24B family.

506 amino acids

MLSLLSTPRLVPVIARLRGLSGCMSCLQRRYSLQPVPVKEIPNRYLGQPSPVTHPHLLRPGEVTPGLSQVEYALRRHKLMALVHKEAQGHSGTDHTVVVLSNPIHYMSNDIPYTFHQDNSFLYLCGFQEPDSILVLQSCSGKQLPSHKAMLFVPRRDPGRELWDGPRSGTDGAIALTGVDDAYPLEEFQHLLPKLRAETNMVWYDWMKPSHAQLHSDYMQPLTEAKATSKNKVRSVQHLIQHLRLIKSPAEIKRMQIAGKLTSEAFIETMFASKAPVDEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQKACLTLCSPGTSLENIYSMMLTLMGQKLKDLGIIKTSKESAFKAARKYCPHHVGHYLGMDVHDTPDMPRSLPLQPGMVITVEPGIYIPEGDTDAPEKFRGLGVRIEDDVVVTQDSPLILSADCPKEVNDIEQICSRTS

56.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Xpnpep3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here