Membrane-bound metalloprotease which catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro. May play a role in the metabolism of the vasodilator bradykinin.

Belongs to the peptidase M24B family.

674 amino acids

MAQAYWQCYPWLVLLCACAWSYPGPESLGREDVRDCSTNPPRLPVTAVNTTMRLAALRQQMEKSNLSAYIIPDTDAHMSEYIGKHDERRAWISGFTGSAGTAVVTKKKAAVWTDSRYWTQAERQMDCNWELHKEVSISSIVAWILAEVPDGENVGFDPFLFSVGSWENYDQELQDSNRHLLSITTNLVDVAWGSERPPVPSQPIYALPKEFTGSTWQEKVSAIRSYMQNHTMAPTGVLLSALDETAWLFNLRSSDIPYNPFFYSYTLLTDSSIRLFVNKSRFSLETLQYLNTNCTLPMCVQLEDYSQIRDGVKAYASGNVKILIGISYTTYGVYDVIPKEKLVTETYSPVMLIKAVKNSKEQALLKASHVRDAVAVIQYLVWLEKNVPKGTVDEFSGAEHIDQLRRNENFSSGPSFETISASGLNAALAHYSPTKELHRKLSLDEMYLVDSGGQYWDGTTDITRTVHWGTPTAFQKEAYTRVLMGNIDLSRLVFPAATSGRVVEAFARRALWEVGLNYGHGTGHGIGNFLCVHEWPVGFQYNNMAMAKGMFTSIEPGYYQDGEFGIRLEDVALVVEAKTKYPGTYLTFELVSFVPYDRNLIDVSLLSPEQLQYLNRYYQTIRENIGPELQRRQLLEEFAWLERHTEPLSASAPHTTSLASMWVASALAILSWSC

76.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Xpnpep2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here