Induces disassembly of actin filaments in conjunction with ADF/cofilin family proteins. Doesn't sever actin filaments alone, but caps the barbed ends of filaments severed by cofilin, which blocks annealing and depolymerization and allows more extensive severing by cofilin.

Belongs to the WD repeat AIP1 family.

607 amino acids

MPYELKKVFASLPQMERGVAKILAGDPKGNNFLYTNGKSVIIRNIDNPAIADIYTEHAHQAVVARYAPSGFYIASGDTSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFASVFLWDTGSSVGEITGNIKVINSVDIKQTRPYRLVTGSDDNCCAFLEGPPFKFKFTMSDHSRFVNCVRFSPDGSKLASAGADGQIFLYDGKTGEKVCSLGGSKAHDGGIYAVSWSPDGTQLLSASGDKTTKIWDVAANSAVTTFNLGSDVLDQQLGCLWQKDYLLSVSLSGYINYLDKNNPARPLRVIKGHNKSIQCMTVNNSDGRSTIYTGSHDGHINYWDAETGENDTFTGKGHTNQVSSMDLDGCNQLITCSMDDTLRYTSLISKDYSSSESVKMDVQPKCVAVGSGGYVVTVCIGQIVLLKDKKKVFAIDSLDYEPEAVAIHKGSGTVAVGGADGKVHLYSIQGNSLKDEGKTLPAKGAVTDLAYSHDGAFLAVTDANKVVTVFSVADGYSEKNSYYGHHAKALSVAWSPDNEHFASSGMDMMVYVWTLSDPDTRIKMPDAHRLHHVSSLAWLDEHTLATVSHDACVKQWTVTFK

66.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make wdr1-a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here