Molecular scaffold protein for various multimeric protein complexes. Acts as a module in the assembly of a multicomponent scaffold for the ERK pathway, linking ERK responses to specific agonists. Also involved in response to hypoxia (By similarity).

Belongs to the WD repeat MORG1 family.

325 amino acids

MVKISCNKVLSNHSGSVTVVKYNSDGGYCLSGSSDKSIKLYNVSKGSMIHSFEEHGYGIGDLVSTSDNKQLFSCAEKQLYQWDIASGQVIRRFQNAHNDTITSVCVNLDSTLLFSGSSDRLVKAWDLRTKSINPVQILDDAKDTITSIIVNEQTITHNHSHGHGHSHGNNNNNQPHTHTQKEVITSSVDGCIRTYDVRMGTLVTYEDTIPISSVSITKDKKCFIASCTDETVKLIDIDSYETLKEYKGHKNKVYKINSCSNFDDSLIISGSEDNDFYIYELLSGKLLSKLSGHSNIITHVDSHPSKNQFITSSTDCTIRIWDQSE

36.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make morg1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here