Thought to stabilize the calcium channel in an inactivated (closed) state (By similarity). Modulates calcium current when coexpressed with CACNA1G.

Belongs to the PMP-22/EMP/MP20 family. CACNG subfamily.

211 amino acids

MTAIGAQAHKLLGLKRPHRSFFESFIRTLIIVCTALAVVLSSVSICDGHWLLVEDHLFGLWYFCTIGNHSEPHCLRDLSQAHMPGLAVGMGLARSVAAMAVVAAIFGLEMLIVSQVCEDVRSRRKWAIGSYLLLVAFILSSGGLLTFIILLKNQINLLGFTLMFWCEFTASFLFFLNAASGLHINSLTQPWDPPAGTLAYRKRGYDGTSLI

23.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Tmem37 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here