Envelope protein which is a major component of the mature virion (MV) membrane. Essential for membrane biogenesis. Is required, together with A17, to form bona fide crescents, which can progress to form the immature virion (IV) membrane. A14 and A17 form a lattice that is stabilized by disulfide bonds and serves as an anchor within the viral membrane to which several other proteins important in virion structure and morphogenesis attach (By similarity).

Belongs to the chordopoxvirinae A14 family.

91 amino acids

MDPLGFFRNRPSYVVVFGIILLIVACICAYIELSKSGKPADSALRSISIISFILAILLLLGIILFSGYNRYCTGNVVDESRYATSPGTEIQ

10 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FPV179 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here