About Products Protein Database Contact

Protein expression services for vif | Virion infectivity factor

Description
Counteracts the innate antiviral activity of APOBEC3G. Forms a complex with host APOBEC3G thus preventing the entry of this lethally hypermutating enzyme into progeny virions. Functions as an adapter molecule, recruiting APOBEC3G to the ubiquitin-proteasome machinery. Targets APOBEC3G for degradation through the assembly with elongin BC complex, CUL5 and RBX1. Binds viral RNA and affects the stability of viral nucleoprotein core. May play a role in viral morphology (By similarity).
Family
Belongs to the primate lentivirus group Vif protein family.
Species
Simian immunodeficiency virus agm.vervet (isolate AGM3)
Length
232 amino acids
Sequence
MNQEKEWVMRVTWKVPEELITKWQGIVRYWMRTRKLDWKYRMHYQITWAWYTMSRYEIPLGQHGSIHVDLYWHLTPEKGWLSTYAEGIQYLSNRDPWYRTELDPATADSLIHTHYFTCFTERAIRKALLGQRFTFCQFPEGHKKTGQVPSLQYLALLAHQNGLRQRSQRSKTGGTRNMGFEQGAVGRMAKRHARRYQSGSQDAFWARAPVPSMELLSGGGRKESHSHARKGL
Mass
27.4 kDa
Simulated SDS-PAGE
Western blot of vif recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make vif using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here