About Products Protein Database Contact

Protein expression services for vif | Virion infectivity factor

Description
Counteracts the innate antiviral activity of host APOBEC3F and APOBEC3G. Forms a complex with host APOBEC3F and APOBEC3G thus preventing the entry of these lethally hypermutating enzymes into progeny virions. Recruits an active E3 ubiquitin ligase complex composed of elongin BC, CUL5, and RBX2 to induce polyubiquitination of APOBEC3G and APOBEC3F. In turn, they are directed to the 26S proteasome for degradation. Vif interaction with APOBEC3G also blocks its cytidine deaminase activity in a proteasome-independent manner, suggesting a dual inhibitory mechanism. May interact directly with APOBEC3G mRNA in order to inhibit its translation. Seems to play a role in viral morphology by affecting the stability of the viral nucleoprotein core. Finally, Vif also contributes to the G2 cell cycle arrest observed in HIV infected cells.
Family
Belongs to the primate lentivirus group Vif protein family.
Species
Human immunodeficiency virus type 1 group M subtype A (isolate MAL)
Length
192 amino acids
Sequence
MENRWQVMIVWQVDRMRIRTWHSLVKHHMYVSKKAKNWFYRHHYESRHPKVSSEVHIPLGDARLVVRTYWGLQTGEKDWHLGHGVSIEWRQKRYSTQLDPDLADQLIHLYYFDCFSESAIRQAILGHIVSPRCDYQAGHNKVGSLQYLALTALIAPKKTRPPLPSVRKLTEDRWNKPQQTKGHRGSHTMNGH
Mass
22.7 kDa
Simulated SDS-PAGE
Western blot of vif recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make vif using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here