Description
Counteracts the innate antiviral activity of APOBEC3G. Forms a complex with host APOBEC3G thus preventing the entry of this lethally hypermutating enzyme into progeny virions. Functions as an adapter molecule, recruiting APOBEC3G to the ubiquitin-proteasome machinery. Targets APOBEC3G for degradation through the assembly with elongin BC complex, CUL5 and RBX1. Binds viral RNA and affects the stability of viral nucleoprotein core. May play a role in viral morphology (By similarity).
Family
Belongs to the primate lentivirus group Vif protein family.
Species
Human immunodeficiency virus type 2 subtype A (isolate ST)
Sequence
MEEGKRWIAVPTWRVPGRMERWHSLIKYLKYRTGDLEKVCYVPHHKVGWAWWTCSRVIFPLKGESHLEIQAYWNLTPEKGWLSSYSVRLTWYTEKFWTDVTPDCADSLIHSTYFSCFTAGEVRRAIRGEKLLSCCNYPQAHKYQVPSLQFLALVVVQQNGRPQRDNTTRKQWRRNYRRGLRVARQDGRSHKQRGSEPPAPRAYFPGVAKVLEILA
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service