DNA-binding protein that plays a critical role in viral DNA replication and gene expression. Binds to both ssDNA and dsDNA with a binding site covering about 15 nucleotides. Displays DNA-supercoiling activity only when associated with the viral DNA topoisomerase 2.

Belongs to the bacterial histone-like protein family.

104 amino acids

MSTKKKPTITKQELYSLVAADTQLNKALIERIFTSQQKIIQNALKHNQEVIIPPGIKFTVVTVKAKPARQGHNPATGEPIQIKAKPEHKAVKIRALKPVHDMLN

11.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Mal-043 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here