Catalyzes the last of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme reduces the trans-2,3-enoyl-CoA fatty acid intermediate to an acyl-CoA that can be further elongated by entering a new cycle of elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.

Belongs to the steroid 5-alpha reductase family.

300 amino acids

MVDIKVVSQRSKKEVGSFSTSSSTTVGELKKQISSKTRLGTERIRLAVPSKTSKLPNAFEALGKDSDLVSKHVGADSTLYFKDLGPQISWSLVFICEYAGPLFVYPIFYFLSNLIYGTDSPKSFAQKVALVCYSLHYIKRIYETIFVHRFSHGTMPIFNLFKNCSYYWGCTAMVSYFVNHPLYTEAPIERVYLGLGLWIIGEVFNYICHIQLRNLRPAGSTERKIPRGLLFEFVSCPNYTVEILSWIGFSILTQTLTSWIFALMGAAQMWIWAVGKHRRYRKEFGDKYPKSRKILIPFLL

34.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gpsn2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here