Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. Catalyzes the reduction of the 3-ketoacyl-CoA intermediate that is formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids.

Belongs to the short-chain dehydrogenases/reductases (SDR) family.

324 amino acids

MIETCLCWVGGIFIVTCIAYVVYVALEVHVFPGRSLTTYGANPKLRGAGSWALVTGATDGIGREFAMQLAARGFNIVAVSRTAEKLAILSKEIESTMPGIKTCYYAMDFLSAGNAEYEGLEQLIRHLDIAVLVNNVGLSHTMPVNFLEMDGRELASICQVNIVATMQVTRVVAPHLVRRGRGLILNLGSFSGQWSTPLLATYAGSKAFLIAWTQALGEEMRRSHVDVQLLNTYFVVSSMSKVRKPSMMVPTPKNFVRSALSRIGRSSGALGRPFTLTPFPSHAWLDWAVEHFVPRWWLLRQAYDVSLDTRRRAIRKAQRLEKSQ

36 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MGL_1839 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here