Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.

Belongs to the very long-chain fatty acids dehydratase HACD family.

218 amino acids

MKTYLSIYYLIQFCGHSWIFTNMTTRFLFFGQDAFADTFYSIGLVMQGCQLLSILELAHILLGVEQNGFLPMFLQVAERFIILFVVITSQEEVQSKYIVCALFFIWNLWDVIRYPYDMLAAVDTDYSALTWLRHTWWIVAYPLSVLAEAYTIYESLPYFESLGTYSFKMALPVSLSFHFPYILTLYLVLQPVGMLYICSCLWSERKQYFQRKLKLKKN

25.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make hacd4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here