Transcription factor that is required for closure of the choroid fissure and together with Vax2 is required for optic nerve differentiation and to limit retinal development to the optic cup.

Belongs to the EMX homeobox family.

317 amino acids

MEVRYSQDSESGMLLKNGLKEGKEGKDSQGSISKTFLKDQQESFSPSGAVENCEKSRASSGDPDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCSVLRLLEQGRLLTPPGLPGLLPHCGSSSLGSALRGPSLGITANGGSSSSSRSSAGSSGTAGGSPPLPTVTSSGTVTGLQGSPPAHGLFSFPMPSLLGSVASRISSTPLGMAGSLAGNLQELSARYLCSSAFEPYSRTNGKEALDKKVLE

33.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make vax1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here