Vacuolar v-SNARE required for docking. Only involved in homotypic vacuole fusion. Required for Ca(2+) efflux from the vacuolar lumen, a required signal for subsequent membrane fusion events, by inhibiting vacuolar Ca(2+)-ATPase PMC1 and promoting Ca(2+) release when forming trans-SNARE assemblies during the docking step.

Belongs to the synaptobrevin family.

253 amino acids

MKRFNVSYVEVIKNGETISSCFQPFQKNENYGTITSANEQITPVIFHNLIMDMVLPKVVPIKGNKVTKMSMNLIDGFDCFYSTDDHDPKTVYVCFTLVDMPKILPIRILSGLQEYESNATNELLSSHVGQILDSFHEELVEYRNQTLNSSGNGQSSNGNGQNTISDIGDATEDQIKDVIQIMNDNIDKFLERQERVSLLVDKTSQLNSSSNKFRRKAVNIKEIMWWQKVKNITLLTFTIILFVSAAFMFFYLW

29 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make NYV1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here