About Products Protein Database Contact

Protein expression services for rag2 | V(D)J recombination-activating protein 2

Description
Core component of the RAG complex, a multiprotein complex that mediates the DNA cleavage phase during V(D)J recombination. V(D)J recombination assembles a diverse repertoire of immunoglobulin and T-cell receptor genes in developing B and T lymphocytes through rearrangement of different V (variable), in some cases D (diversity), and J (joining) gene segments. DNA cleavage by the RAG complex occurs in 2 steps: a first nick is introduced in the top strand immediately upstream of the heptamer, generating a 3'-hydroxyl group that can attack the phosphodiester bond on the opposite strand in a direct transesterification reaction, thereby creating 4 DNA ends: 2 hairpin coding ends and 2 blunt, 5'-phosphorylated ends. In the RAG complex, rag2 is not the catalytic component but is required for all known catalytic activities mediated by RAG1. It probably acts as a sensor of chromatin state that recruits the RAG complex to H3K4me3 (By similarity).
Family
Belongs to the RAG2 family.
Species
Xenopus laevis
Length
520 amino acids
Sequence
MTLRIVTPGSNTSLIQPGFSLLHFSSHVFYLGQKGWPKRSCPTGVFLLDLKNNDLKLRPATFTNDSCYLPPLRHPAVCSFSASQGGEITQYLIHGGKTPNNEISHKLYIMTMAFPVNKRFSLCCSEKDLAGDVPEARYGHSMNVVFSRGKNAVVMFGGRSYMPLNQRTTENWNNVIDCEPLVYLIDLQFGCSTSFNLRELQDGLSFHVSLARNDTVYIFGGHSLGNNFRPPNVYKIKVDLPLGSPAVSCTVINSKISFSSSIVTQTSPDEFVIVGGYESDSQKRLICNGVFLDDETIDIQEIETPDWTGEIKHSKTWFGADMGKGAVLFGIPVDNKHQSTDCSFFFYVLNFGDNDPALQTCSQGSTEEQEDSMPLEDSEEFTFNRDGNIFDEDTYNEDDEDDESVTGYWIKCCPDCDMDRNTWEPFYSTELNKPSMIFCSKDGGHWVHSQCMDLSETMLKYLSQNNIKYFCNEHVEVARGVQTPEKTPPVKKTSLKSVRKRTTINRLSAVKKSFLRRLFE
Mass
58.6 kDa
Simulated SDS-PAGE
Western blot of rag2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make rag2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here