Catalyzes cyclization of the linear tetrapyrrole, hydroxymethylbilane, to the macrocyclic uroporphyrinogen III, the branch point for the various sub-pathways leading to the wide diversity of porphyrins. Porphyrins act as cofactors for a multitude of enzymes that perform a variety of processes within the cell such as methionine synthesis (vitamin B12) or oxygen transport (heme) (By similarity).

Belongs to the uroporphyrinogen-III synthase family.

265 amino acids

MKVLLLKDAKEDDSGLDPYIQELRLCGLEATLIPVLSFEFMSLPSLSEKLSHPEGFGGLIFTSPRAVEAVKLCLEKDNKTEAWEKSLKDRWNAKSVYVVGSATASLVNKIGLDAEGAGSGNAEKLAEYICSKPSSELPLLFPCGTIKGDTLPKMLKDKGIPMESMHVYQTVPHPGIQGSLKSYYEDQGIPASITFFSPSGLKYSLEYIQALSGSSFDQIKFIAIGPSTTRAMAAKGLPVSCTAESPTPQALAAGIRNVLKPNHCC

28.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Uros using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here