Catalyzes the decarboxylation of four acetate groups of uroporphyrinogen-III to yield coproporphyrinogen-III.

Belongs to the uroporphyrinogen decarboxylase family.

350 amino acids

MGVTSTAPHLLRAARGEIVDRPPVWMMRQAGRYMKAYRDLREKYPSFRDRSEIPEVAIEVSLQPWKAFQPDGVILFSDIVTPLPGLGIEMDIAEGKGPIIHAPIRTQAQIEQLRPLEPEAALPFIKTILQALRQEVGNQSTVLGFVGAPWTLAAYAVEGKGSKTYSIIKNMAFSDPTILHQLLSKLADAIAIYARYQIDSGAQVVQMFDSWAGQLSPQDYDTFALPYQQRVFQQIKQTHPDTPLILLVSGSAGVLERMGQSGADIVTVDWTVDMADARARLGKQMKVQGNLDPGVLYASKQFIRDRIIDTVRKAGNWGHILNLGHGVLPDTPEENVAFFFETAKQLNVLV

38.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make hemE using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here