Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in AUM-cytoskeleton interaction in terminally differentiated urothelial cells. It also contributes to the formation of urothelial glycocalyx which may play an important role in preventing bacterial adherence (By similarity).

Belongs to the uroplakin-3 family.

279 amino acids

MGLPSRQPRLWLLLLVVLGWPQPCLTLDLIPYTPRITSWDLEGKVTATTFSLEQPRCVLDRHSSAADTVWLVVAFSNASRVFQNPQTLAEIPASPRLLTDGHYMTLPLTMDQLPCEDPADGSGRAPVLRVGNDAGCLADLHQPRYCNAPLPGPGPYRVKFLLTNSRGSPQAETRWSDLIALRQGKSPGSIDTWPGRRSGDMIIITSILSSLAGLLLLAFLAASSVRFSSLWWPEEAPEQLRIGSFMGKRYMTHHIPPSEAATLPVGCEPGLERFPSLSP

30.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make UPK3B using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here