Catalyzes the oxidation of beta-D-galacturonate and beta-D-glucuronate to galactarate and D-glucarate, respectively. Cannot use NADP(+) instead of NAD(+) as cosubstrate.

Belongs to the NAD(P)-dependent epimerase/dehydratase family.

275 amino acids

MASAHTTQTPFNRLLLTGAAGGLGKVLRETLRPYSHILRLSDIAEMAPAVGDHEEVQVCDLADKDAVHRLVEGVDAILHFGGVSVERPFEEILGANICGVFHIYEAARRHGVKRVIFASSNHVIGFYKQNETIDAHSPRRPDSYYGLSKSYGEDMASFYFDRYGIETVSIRIGSSFPEPQNRRMMSTWLSFDDLTRLLERALYTPDVGHTVVYGVSDNKTVWWDNRFASKLDYAPKDSSEVFRAKVDAQPMPADDDPAMVYQGGAFVASGPFGDK

30.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make udh using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here