Catalyzes the catabolism of the allantoin degradation intermediate (S)-ureidoglycolate, generating urea and glyoxylate. Involved in the utilization of allantoin as nitrogen source.

Belongs to the ureidoglycolate lyase family.

170 amino acids

MRTLTIEPLTKDAFAPFGDVIETDGSDHFMINNGSTMRFHRLAEVDTAQPDDKAIISIFRAESLPMPLTIGMLERHPQGSQAFIPLLGNPFLIVVAPVGDAPESALTRAFVSNGRQGVNYHRGVWHHPVLTIEKQDDFLVVDRSGSGNNCDEHYFEENQRLVLDPNPQEG

18.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make allA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here